PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna29961.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 378aa    MW: 42127.8 Da    PI: 4.8445
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna29961.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161764148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W++ Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
  mrna29961.1-v1.0-hybrid 17 RGPWSPSEDLRLISFIQKHGHDNWRALPKQAGLLRCGKSCRLRWINYL 64
                             89******************************99************97 PP

2Myb_DNA-binding50.54.9e-1670115148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+eE+e ++ +++ +G++ W++Ia++++ gRt++++k+ w+++l
  mrna29961.1-v1.0-hybrid  70 RGNFTKEEEESIIMLHEAWGNK-WSKIASHFP-GRTDNEIKNVWNTHL 115
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23867IPR009057Homeodomain-like
PROSITE profilePS5129414.3311264IPR017930Myb domain
SuperFamilySSF466892.02E-2915111IPR009057Homeodomain-like
SMARTSM007175.3E-131666IPR001005SANT/Myb domain
PfamPF002492.1E-151764IPR001005SANT/Myb domain
CDDcd001671.22E-91964No hitNo description
PROSITE profilePS5129424.72765119IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2668119IPR009057Homeodomain-like
SMARTSM007171.6E-1469117IPR001005SANT/Myb domain
PfamPF002499.3E-1570115IPR001005SANT/Myb domain
CDDcd001673.96E-1072115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MVGRGRTPCC DKSQVKRGPW SPSEDLRLIS FIQKHGHDNW RALPKQAGLL RCGKSCRLRW  60
INYLRPDLKR GNFTKEEEES IIMLHEAWGN KWSKIASHFP GRTDNEIKNV WNTHLRKKLA  120
LKYSCGDDQS KELSSITSSS SSSSSSSASF QLSSGEPSAG VTAELQNQPN QESNTSKTRN  180
DCELPDSLTI QEKLEKKLPM EVTDQVRVDD AVGMKMLTTS SSFSSYASSN GSSSSQGGGV  240
SRPDDLVFDL KGAYEPQIAD KAVFEIPFES DYGFWNMLDG TLSFEGNPEP LLPQADQTYQ  300
SSNLELVESG NWLSYLEKEL GLEDSTKTNN QDFVMKDATE QLASEKYCDK LPKPTEMDHG  360
MDDYFGMWPP LPENSAN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C8e-26171194105C-Myb DNA-Binding Domain
1mse_C8e-26171194105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460714.10.0PREDICTED: myb-related protein 330
RefseqXP_004294062.10.0PREDICTED: myb-related protein 330
TrEMBLM5WMX01e-111M5WMX0_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s09930.13e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-71myb domain protein 63